PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof018471
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family HSF
Protein Properties Length: 157aa    MW: 17308.4 Da    PI: 12.1972
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-92715PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind851e-262994267
                  HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE--- CS
  HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkkvkd 67
                  Fl+k+++++e+++++e+isw ++g+sfvv++++e+a+++Lp +Fkh nf+SFvRQLn+YgF+kv  
     Sof018471 29 FLTKTHQMVEERATDEVISWADQGRSFVVWKPRELARDLLPLHFKHFNFSSFVRQLNTYGFRKVGA 94
                  9**************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.5E-2924106IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004151.0E-3225121IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467854.49E-2525106IPR011991Winged helix-turn-helix DNA-binding domain
PRINTSPR000568.2E-182952IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004471.7E-2329105IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000568.2E-186779IPR000232Heat shock factor (HSF)-type, DNA-binding
PROSITE patternPS0043406892IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000568.2E-188092IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MEEAVAVAVA AASKSSGGRG GGGRRPAPFL TKTHQMVEER ATDEVISWAD QGRSFVVWKP  60
RELARDLLPL HFKHFNFSSF VRQLNTYGFR KVGAGPVXRF SNDNFPWRRA KAFWPASGRR  120
RSTTPKSFNK SVGSGGVNVG FLRRPLPRGS GEGTRLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d8k_B2e-172992568Heat shock factor protein 2
5d8l_B2e-172992568Heat shock factor protein 2
5d8l_D2e-172992568Heat shock factor protein 2
5d8l_F2e-172992568Heat shock factor protein 2
5d8l_H2e-172992568Heat shock factor protein 2
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11622GGRGGGG
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.156250.0bud| crown| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002460330.18e-46hypothetical protein SORBIDRAFT_02g026590
SwissprotQ67TP92e-42HSFB1_ORYSJ; Heat stress transcription factor B-1
TrEMBLC5X2A99e-46C5X2A9_SORBI; Putative uncharacterized protein Sb02g026590
STRINGSb02g026590.13e-45(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G11660.16e-30HSF family protein